 |
||||||||
|
||||||||
 |
||||||||
Cleavage and polyadenylation specificity factor subunit 2
Known also as: Cleavage and polyadenylation specificity factor 100 kDa subunit
Known abbreviations: CPSF2, CPSF100, KIAA1367
Yeast homolog: CFT2
Protein
Models Domains Secondary structure Disorder |
Top 3 models:
 |  |  |
| Template: 2i7x, chain A Method: hhsearch Fragment: 5-600 | Template: 3zq4, chain A Method: mgenthreader Fragment: 605-782 | Template: 3zq4, chain A Method: hhsearch Fragment: 1-596 |
| Sequence length: | 782 aa |
| Molecular weight: | 88.487 kDa |
| Isoelectric point: | 4.85 |
Sequence:
1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130
MTSIIKLTTLSGVQEESALCYLLQVDEFRFLLDCGWDEHFSMDIIDSLRKHVHQIDAVLLSHPDPLHLGALPYAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFTLFTLDDVDAAFDKIQQLK
FSQIVNLKGKGHGLSITPLPAGHMIGGTIWKIVKDGEEEIVYAVDFNHKREIHLNGCSLEMLSRPSLLITDSFNATYVQPRRKQRDEQLLTNVLETLRGDGNVLIAVDTAGRVLELAQLLDQIWRTKDAG
LGVYSLALLNNVSYNVVEFSKSQVEWMSDKLMRCFEDKRNNPFQFRHLSLCHGLSDLARVPSPKVVLASQPDLECGFSRDLFIQWCQDPKNSIILTYRTTPGTLARFLIDNPSEKITEIELRKRVKLEGK
ELEEYLEKEKLKKEAAKKLEQSKEADIDSSDESDIEEDIDQPSAHKTKHDLMMKGEGSRKGSFFKQAKKSYPMFPAPEERIKWDEYGEIIKPEDFLVPELQATEEEKSKLESGLTNGDEPMDQDLSDVPT
KCISTTESIEIKARVTYIDYEGRSDGDSIKKIINQMKPRQLIIVHGPPEASQDLAECCRAFGGKDIKVYMPKLHETVDATSETHIYQVRLKDSLVSSLQFCKAKDAELAWIDGVLDMRVSKVDTGVILEE
GELKDDGEDSEMQVEAPSDSSVIAQQKAMKSLFGDDEKETGEESEIIPTLEPLPPHEVPGHQSVFMNEPRLSDFKQVLLREGIQAEFVGGVLVCNNQVAVRRTETGRIGLEGCLCQDFYRIRDLLYEQYA
IV
Gene location: 14q31.1
Summary
CPSF2 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. Involved in the histone 3' end pre-mRNA processing.
The exact function of this protein in 3?-end processing is currently not known.
CPSF-100 has recognizable sequence homology to CPSF-73 (23% identity and 49% similarity for their metallo-?-lactamase domains).Therefore, CPSF-100 is also a member of the ?-CASP superfamily of proteins. However, the zinc-binding residues are not conserved in CPSF-100, and therefore CPSF-100 cannot bind zinc and is not expected to be catalytically active.
Interacts with CPSF3, CSTF2, Ssu72, SYMPK, Pcf11p of CF IA, and the CTD of PolII.
Like CPSF-73, CPSF-100 has a second isoform in humans, known as RC-74 or Int11, also with disrupted zinc binding sites.
See this protein in other databases:
Literature:
- Murthy KG, Manley JL. Characterization of the multisubunit cleavage-polyadenylation specificity factor from calf thymus. J Biol Chem 1992 267(21):14804-11, doi: , PMID: 1634525.
- Mandel CR, Kaneko S, Zhang H et al. Polyadenylation factor CPSF-73 is the pre-mRNA 3"-end-processing endonuclease. Nature 2006 444(7121):953-6, doi: 10.1038/nature05363, PMID: 17128255.
- Sullivan KD, Steiniger M, Marzluff WF et al. A core complex of CPSF73, CPSF100, and Symplekin may form two different cleavage factors for processing of poly(A) and histone mRNAs. Mol Cell 2009 34(3):322-32, doi: 10.1016/j.molcel.2009.04.024, PMID: 19450530.
- Schul W, Groenhout B, Koberna K et al. The RNA 3" cleavage factors CstF 64 kDa and CPSF 100 kDa are concentrated in nuclear domains closely associated with coiled bodies and newly synthesized RNA. EMBO J 1996 15(11):2883-92, doi: , PMID: 8654386.
| Previous Cleavage and polyadenylation s... |
Home | Next Cleavage and polyadenylation s... |
|
|
