 |
||||||||
|
||||||||
 |
||||||||
Polyadenylate-binding protein 3
Known also as: Poly(A)-binding protein 3, Testis-specific poly(A)-binding protein
Known abbreviations: PABP-3, PABP3, PABPC3, PABPL3, tPABP
Yeast homolog: not known
Protein
Structures Models Domains Secondary structure Disorder |
This protein is highly disordered (48 % of residues are predicted to be disordered)
Top 3 models:
 |  |  |
| Template: 2ghp, chain A Method: hhsearch Fragment: 51-372 | Template: 2ghp, chain A Method: hhsearch Fragment: 1-270 | Template: 1g9l, chain A Method: hhsearch Fragment: 486-632 |
| Sequence length: | 631 aa |
| Molecular weight: | 70.031 kDa |
| Isoelectric point: | 10.0 |
Sequence:
1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130
MNPSTPSYPTASLYVGDLHPDVTEAMLYEKFSPAGPILSIRICRDLITSGSSNYAYVNFQHTKDAEHALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFVKNLDKSINNKALYDTVSAFGNILSCNV
VCDENGSKGYGFVHFETHEAAERAIKKMNGMLLNGRKVFVGQFKSRKEREAELGARAKEFPNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQ
IYVGRAQKKVERQTELKRTFEQMKQDRITRYQVVNLYVKNLDDGIDDERLRKAFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAYLTNEYMQRMASVR
AVPNQRAPPSGYFMTAVPQTQNHAAYYPPSQIARLRPSPRWTAQGARPHPFQNKPSAIRPGAPRVPFSTMRPASSQVPRVMSTQRVANTSTQTVGPRPAAAAAAAATPAVRTVPRYKYAAGVRNPQQHRN
AQPQVTMQQLAVHVQGQETLTASRLASAPPQKQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLYMLESPESLRSKVDEAVAVLQAHQAKEATQKAVNSATGVPTV
Gene location: 13q12-q13
Summary
PABP-3 binds the poly(A) tail of mRNA. May be involved in cytoplasmic regulatory processes of mRNA metabolism. Binds poly(A) with a slightly lower affinity as compared to PABPC1.
Testis specific.
Messenger RNA stability and translation initiation are extensively under the control of poly(A)-binding proteins (PABP). See PABPC1 for background information.
See this protein in other databases:
Literature:
- Feral C, Guellaen G, Pawlak A et al. Human testis expresses a specific poly(A)-binding protein. Nucleic Acids Res 2001 29(9):1872-83, doi: , PMID: 11328870.
- Mangus DA, Evans MC, Jacobson A et al. Poly(A)-binding proteins: multifunctional scaffolds for the post-transcriptional control of gene expression. Genome Biol 2003 4(7):223, doi: 10.1186/gb-2003-4-7-223, PMID: 12844354.
- Kuhn U, Wahle E. Structure and function of poly(A) binding proteins. Biochim Biophys Acta 2004 1678(2-3):67-84, doi: 10.1016/j.bbaexp.2004.03.008, PMID: 15157733.
| Previous Polyadenylate-binding protein ... |
Home | Next Polyadenylate-binding protein ... |
|
|
