|
Cleavage stimulation factor subunit 1Known also as: CF-1 50 kDa subunit, Cleavage stimulation factor 50 kDa subunit Known abbreviations: CSTF1, CstF-50, CstFp50 Yeast homolog: not known Protein
Top 3 models:
Sequence: 1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130 MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADA SIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTEQILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQDQ HTDAICSVNYNSSANMYVTGSKDGCIKLWDGVSNRCITTFEKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYTGAGLSGRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRN LLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRSTTD Gene location: 20q13.2 Summary One of the protein of CSTF complex. Required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs. May be responsible for the interaction of CSTF with other factors to form a stable complex on the pre-mRNA. It contains seven WD-40 repeats that begin about 90 residues from the N-terminus . The WD-40 repeats are required for interaction with CstF-77, and deletion of the last repeat reduces binding. CstF-50 also can self-associate and only the N-terminal region is required for this interaction. CstF-50 does not appear to have a sequence homolog in yeast. WD6 repeat of CstF-50 interacts with protein BARD1, which associates with the tumor suppressor BRCA1. This interaction inhibits 3?-end cleavage of pre-mRNAs in vitro. WD domains are responsible for interaction with CSTF3. Similar to mammalian G protein beta subunits, this protein contains transducin-like repeats. Both CstF-50 and CstF-77 bind specifically to the CTD of PolII but CstF-50 binds with a higher efficiency. This binding is significantly reduced upon deletion of the first 91 amino acids of CstF-50, indicating that the WD-40 repeats are not sufficient for interaction. RNAi experiments showed that CstF-50 also interacts with the splicing co-activator SRm160, establishing another link between 3?-end processing and transcription. Interacts directly with CSTF3. Interacts with BARD1. Acts as homodimer (N-terminus mediates homodimerization). See this protein in other databases: Literature:
|
||||||||||||||||||||||||||||||
|