 |
||||||||
|
||||||||
 |
||||||||
Serine/threonine-protein phosphatase PP1-beta catalytic subunit
Known abbreviations: PP-1B, PP1B, PP1beta, PPP1CB, PPP1CD
Yeast homolog: GLC7
Protein
Models Domains Secondary structure Disorder |
Top 3 models:
 |  |  |
| Template: 1s70, chain A Method: ffas Fragment: 1-326 | Template: 1s70, chain A Method: compass Fragment: 2-306 | Template: 1fjm, chain A Method: hhsearch Fragment: 1-325 |
| Sequence length: | 327 aa |
| Molecular weight: | 37.187 kDa |
| Isoelectric point: | 5.91 |
Sequence:
1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASIN
RIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKR
QLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Enzyme
EC number: 3.1.3.16
Name: Phosphoprotein phosphatase
Reaction: A phosphoprotein + H(2)O <=> a protein + phosphate
EC number: 3.1.3.53
Name: [Myosin-light-chain] phosphatase
Reaction: [Myosin light-chain] phosphate + H(2)O <=> [myosin light-chain] + phosphate
Gene location: 2p23
Summary
Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.
Inhibited by the toxins okadaic acid, tautomycin and microcystin Leu-Arg
See this protein in other databases:
Literature:
- Lee JH, You J, Dobrota E et al. Identification and characterization of a novel human PP1 phosphatase complex. J Biol Chem 2010 285(32):24466-76, doi: 10.1074/jbc.M110.109801, PMID: 20516061.
- Barker HM, Brewis ND, Street AJ et al. Three genes for protein phosphatase 1 map to different human chromosomes: sequence, expression and gene localisation of protein serine/threonine phosphatase 1 beta (PPP1CB). Biochim Biophys Acta 1994 1220(2):212-8, doi: , PMID: 8312365.
| Previous Serine/threonine-protein phosp... |
Home | Next E3 ubiquitin-protein ligase RB... |
|
|
