|
Serine/threonine-protein phosphatase PP1-beta catalytic subunitKnown abbreviations: PP-1B, PP1B, PP1beta, PPP1CB, PPP1CD Yeast homolog: GLC7 Protein
Top 3 models:
Sequence: 1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130 MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASIN RIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKR QLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR Enzyme EC number: 3.1.3.16 Name: Phosphoprotein phosphatase Reaction: A phosphoprotein + H(2)O <=> a protein + phosphate EC number: 3.1.3.53 Name: [Myosin-light-chain] phosphatase Reaction: [Myosin light-chain] phosphate + H(2)O <=> [myosin light-chain] + phosphate Gene location: 2p23 Summary Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. Inhibited by the toxins okadaic acid, tautomycin and microcystin Leu-Arg See this protein in other databases: Literature:
|
||||||||||||||||||||||||||||||
|