 |
||||||||
|
||||||||
 |
||||||||
Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
Known abbreviations: PP-1A, PP1A, PP1alpha, PPP1A, PPP1CA
Yeast homolog: GLC7
Protein
Structures Models Domains Secondary structure Disorder |
Top 3 models:
 |  |  |
| Template: 1fjm, chain A Method: hhsearch Fragment: 1-330 | Template: 3e7a, chain A Method: hhsearch Fragment: 1-300 | Template: 1s70, chain A Method: phyre Fragment: 1-205 |
This protein has alternative isoforms:
Isoform 1:
| Sequence length: | 330 aa |
| Molecular weight: | 37.512 kDa |
| Isoelectric point: | 6.05 |
1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASI
NRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAK
RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Isoform 2:
| Sequence length: | 341 aa |
| Molecular weight: | 38.631 kDa |
| Isoelectric point: | 6.35 |
1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130
MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFF
LLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQ
VVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Enzyme
EC number: 3.1.3.16
Name: Phosphoprotein phosphatase
Reaction: A phosphoprotein + H(2)O <=> a protein + phosphate
Gene location: 11q13
Summary
Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca. Increased PP1 activity has been observed in the end stage of heart failure. Studies in both human and mice suggest that PP1 is an important regulator of cardiac function. Mouse studies also suggest that PP1 functions as a suppressor of learning and memory.
Interacts with PPP1R39
See this protein in other databases:
Literature:
- Cohen PT. Protein phosphatase 1--targeted in many directions. J Cell Sci 2002 115(Pt 2):241-56, doi: , PMID: 11839776.
- Lee JH, You J, Dobrota E et al. Identification and characterization of a novel human PP1 phosphatase complex. J Biol Chem 2010 285(32):24466-76, doi: 10.1074/jbc.M110.109801, PMID: 20516061.
- Song Q, Khanna KK, Lu H et al. Cloning and characterization of a human protein phosphatase 1-encoding cDNA. Gene 1993 129(2):291-5, doi: , PMID: 8392016.
| Previous pre-mRNA 3' end processing pro... |
Home | Next Serine/threonine-protein phosp... |
|
|
