![]() |
![]() |
||||||||||||||||||||||||||||||||||||
|
Serine/threonine-protein phosphatase PP1-alpha catalytic subunitKnown abbreviations: PP-1A, PP1A, PP1alpha, PPP1A, PPP1CA Yeast homolog: GLC7 Protein
Top 3 models:
This protein has alternative isoforms: Isoform 1:
1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130 MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASI NRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAK RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK Isoform 2:
1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130 MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFF LLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQ VVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK Enzyme EC number: 3.1.3.16 Name: Phosphoprotein phosphatase Reaction: A phosphoprotein + H(2)O <=> a protein + phosphate Gene location: 11q13 ![]() Summary Protein phosphatase that associates with over 200 regulatory proteins to form highly specific holoenzymes which dephosphorylate hundreds of biological targets. Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca. Increased PP1 activity has been observed in the end stage of heart failure. Studies in both human and mice suggest that PP1 is an important regulator of cardiac function. Mouse studies also suggest that PP1 functions as a suppressor of learning and memory. Interacts with PPP1R39 See this protein in other databases: ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() Literature:
|
||||||||||||||||||||||||||||||||||||
|