|
WD repeat-containing protein 82Known abbreviations: WDR82, MST107, MSTP107, PRO2730, PRO34047, Swd2, TMEM113, UNQ9342_PRO34047, WDR82A Yeast homolog: not known Protein
Top 3 models:
Sequence: 1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130 MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRVVALSMSPVDDTFISGSLDKT IRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGYANSKAVTLEASFTPDSQFIMIGSED GKIHVWNGESGIKVAVLDGKHTGPITCLQFNPKFMTFASACSNMAFWLPTIDD Gene location: 3p21.2 Summary WDR82 is regulatory component of the SET1 complex implicated in the tethering of this complex to transcriptional start sites of active genes. Facilitates histone H3 'Lys-4' methylation via recruitment of the SETD1A or SETD1B to the 'Ser-5' phosphorylated C-terminal domain (CTD) of RNA polymerase II large subunit (POLR2A). Component of PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. Component of the PTW/PP1 phosphatase complex, composed of PPP1R10/PNUTS, TOX4, WDR82, and PPP1CA or PPP1CB or PPP1CC. Associated with multiple protein complexes including an RNA polymerase II complex. Interacts with CUL4B. Interacts with RBBP5 and SETD1B. Interacts with SETD1A (via RRM domain), POLR2B. Interacts with hyperphosphorylated C-terminal domain (CTD) of RNA polymerase II large subunit (POLR2A). Binds specifically to CTD heptad repeats phosphorylated on 'Ser-5' of each heptad. SETD1A enhances its interaction with POLR2A. Interacts with PPP1R10/PNUTS. Interacts with PPP1CA in the presence of PPP1R10/PNUTS. See this protein in other databases: Literature:
|
||||||||||||||||||||||||||||||
|