 |
||||||||
|
||||||||
 |
||||||||
WD repeat-containing protein 82
Known abbreviations: WDR82, MST107, MSTP107, PRO2730, PRO34047, Swd2, TMEM113, UNQ9342_PRO34047, WDR82A
Yeast homolog: not known
Protein
Models Domains Secondary structure Disorder |
Top 3 models:
 |  |  |
| Template: 1nr0, chain A Method: hhsearch Fragment: 1-313 | Template: 2g9a, chain A Method: phyre Fragment: 8-312 | Template: 2ovr, chain B Method: mgenthreader Fragment: 1-313 |
| Sequence length: | 313 aa |
| Molecular weight: | 35.079 kDa |
| Isoelectric point: | 7.56 |
Sequence:
1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130
MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRVVALSMSPVDDTFISGSLDKT
IRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGYANSKAVTLEASFTPDSQFIMIGSED
GKIHVWNGESGIKVAVLDGKHTGPITCLQFNPKFMTFASACSNMAFWLPTIDD
Gene location: 3p21.2
Summary
WDR82 is regulatory component of the SET1 complex implicated in the tethering of this complex to transcriptional start sites of active genes. Facilitates histone H3 'Lys-4' methylation via recruitment of the SETD1A or SETD1B to the 'Ser-5' phosphorylated C-terminal domain (CTD) of RNA polymerase II large subunit (POLR2A). Component of PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.
Component of the PTW/PP1 phosphatase complex, composed of PPP1R10/PNUTS, TOX4, WDR82, and PPP1CA or PPP1CB or PPP1CC. Associated with multiple protein complexes including an RNA polymerase II complex.
Interacts with CUL4B. Interacts with RBBP5 and SETD1B.
Interacts with SETD1A (via RRM domain), POLR2B.
Interacts with hyperphosphorylated C-terminal domain (CTD) of RNA polymerase II large subunit (POLR2A). Binds specifically to CTD heptad repeats phosphorylated on 'Ser-5' of each heptad. SETD1A enhances its interaction with POLR2A. Interacts with PPP1R10/PNUTS.
Interacts with PPP1CA in the presence of PPP1R10/PNUTS.
See this protein in other databases:
Literature:
- Lee JH, You J, Dobrota E et al. Identification and characterization of a novel human PP1 phosphatase complex. J Biol Chem 2010 285(32):24466-76, doi: 10.1074/jbc.M110.109801, PMID: 20516061.
| Previous E3 ubiquitin-protein ligase RB... |
Home | Next RNA polymerase II subunit A C-... |
|
|
