 |
||||||||
|
||||||||
 |
||||||||
Polyadenylate-binding protein 5
Known also as: Poly(A)-binding protein 5
Known abbreviations: PABP-5, PABP5, PABPC5
Yeast homolog: not known
Protein
Models Domains Secondary structure Disorder |
Top 3 models:
 |  |  |
| Template: 1cvj, chain A Method: hhsearch Fragment: 1-193 | Template: 2ghp, chain C Method: phyre Fragment: 56-379 | Template: 3smz, chain A Method: pdbblast Fragment: 83-375 |
| Sequence length: | 382 aa |
| Molecular weight: | 43.331 kDa |
| Isoelectric point: | 9.84 |
Sequence:
1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130
MGSGEPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPADAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNRALFYLFSAFG
NILSCKVVCDDNGSKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRDRATFTNVFVKNIGDDIDDEKLKELFCEYGPTESVKVIRDASGKSKGFGFVRYETHEAAQKAVLDLH
GKSIDGKVLYVGRAQKKIERLAELRRRFERLRLKEKSRPPGVPIYIKNLDETINDEKLKEEFSSFGSISRAKVMMEVGQGKGFGVVCFSSFEEATKAVDEMNGRIVGSKPLHVTLGQARRRC
Gene location: Xq21.3
Summary
PABP5 binds to the polyA tail found at the 3' end of most eukaryotic mRNAs. It is thought to play a role in the regulation of mRNA metabolic processes in the cytoplasm. The gene is located in a gene-poor region within the X-specific 13d-sY43 subinterval of the chromosome Xq21.3/Yp11.2 homology block. It is located close to translocation breakpoints associated with premature ovarian failure, and is therefore a potential candidate gene for this disorder.
Can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo.
See this protein in other databases:
Literature:
- Blanco P, Sargent CA, Boucher CA et al. A novel poly(A)-binding protein gene (PABPC5) maps to an X-specific subinterval in the Xq21.3/Yp11.2 homology block of the human sex chromosomes. Genomics 2001 74(1):1-11, doi: 10.1006/geno.2001.6530, PMID: 11374897.
- Mangus DA, Evans MC, Jacobson A et al. Poly(A)-binding proteins: multifunctional scaffolds for the post-transcriptional control of gene expression. Genome Biol 2003 4(7):223, doi: 10.1186/gb-2003-4-7-223, PMID: 12844354.
- Kuhn U, Wahle E. Structure and function of poly(A) binding proteins. Biochim Biophys Acta 2004 1678(2-3):67-84, doi: 10.1016/j.bbaexp.2004.03.008, PMID: 15157733.
- Bhattacharjee RB, Bag J. Depletion of Nuclear Poly(A) Binding Protein PABPN1 Produces a Compensatory Response by Cytoplasmic PABP4 and PABP5 in Cultured Human Cells. PLoS One 2012 7(12):e53036, doi: 10.1371/ journal.pone.0053036, PMID: 23300856.
| Previous Polyadenylate-binding protein ... |
Home | Next Poly(A) polymerase alpha |
|
|
