|
Cleavage and polyadenylation specificity factor subunit 4Known also as: Cleavage and polyadenylation specificity factor 30 kDa subunit, CPSF 30 kDa subunit, NS1 effector domain-binding protein 1 Known abbreviations: CPSF4, CPSF30, NAR, NEB1 Yeast homolog: YTH1 Protein
This protein is highly disordered (45 % of residues are predicted to be disordered)
Top 3 models:
This protein has alternative isoforms: Isoform 1:
1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130 MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRG FCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQSNNPPLQRSSSLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTK GHLAFLSGQ Isoform 2:
1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130 MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRG FCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ Isoform 3:
1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130 MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRG FCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ Gene location: 7q22.1 Summary CPSF4 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. CPSF4 binds RNA polymers with a preference for poly(U). CPSF-30 is required for both cleavage and polyadenylation. CPSF-30 has a second isoform in humans (locus XP_945726), sharing 54% sequence identity, but its function is not known. CPSF-30 contains five CCCH zinc finger motifs (ZF1-ZF5) in all eukaryotes, and metazoan CPSF-30 has an additional CCHC zinc knuckle at the C-terminus. CCCH zinc fingers have the consensus sequence CX8CX5CX3H, while CCHC zinc knuckles have the consensus sequence CX2CX4HX4C. CCCH zinc finger motifs are involved in protein-protein interactions (e.g. ZF4 and ZF5 are required for interactions with Fip1p). Association with influenza A virus NS1 blocks processing of pre-mRNAs, thereby preventing nuclear export of host cell mRNAs. The NS1 effector domain functionally interacts with the cellular 30 kDa subunit of cleavage and polyadenylation specific factor 4. In influenza virus-infected cells, the NS1 protein is physically associated with cleavage and polyadenylation specific factor 4, 30kD subunit. Binding of the NS1 protein to the 30 kDa protein in vitro prevents CPSF binding to the RNA substrate and inhibits 3' end cleavage and polyadenylation of host pre-mRNAs. Thus the NS1 protein selectively inhibits the nuclear export of cellular, and not viral, mRNAs. Multiple alternatively spliced transcript variants that encode different isoforms have been described for this gene. See this protein in other databases: Literature:
|
||||||||||||||||||||||||||||||||||||||||||
|