 |
||||||||
|
||||||||
 |
||||||||
Poly(A) RNA polymerase GLD2
Known also as: PAP-associated domain-containing protein 4, Terminal uridylyltransferase
Known abbreviations: PAPD4, GLD2
Yeast homolog: not known
Protein
Models Domains Secondary structure Disorder |
Top 3 models:
 |  |  |
| Template: 2ikf, chain A Method: hhsearch Fragment: 116-476 | Template: 2q0d, chain B Method: phyre Fragment: 132-164 | Template: 2b4v, chain A Method: prc Fragment: 303-473 |
This protein has alternative isoforms:
Isoform 1:
| Sequence length: | 484 aa |
| Molecular weight: | 56.028 kDa |
| Isoelectric point: | 9.65 |
1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130
MFPNSILGRPPFTPNHQQHNNFFTLSPTVYSHQQLIDAQFNFQNADLSRAVSLQQLTYGNVSPIQTSASPLFRGRKRLSDEKNLPLDGKRQRFHSPHQEPTVVNQIVPLSGERRYSMPPLFHTHYVPDIV
RCVPPFREIAFLEPREITLPEAKDKLSQQILELFETCQQQISDLKKKELCRTQLQREIQLLFPQSRLFLVGSSLNGFGTRSSDGDLCLVVKEEPCFFQVNQKTEARHILTLVHKHFCTRLSGYIERPQLI
RAKVPIVKFRDKVSCVEFDLNVNNIVGIRNTFLLRTYAYLENRVRPLVLVIKKWASHHQINDASRGTLSSYSLVLMVLHYLQTLPEPILPSLQKIYPESFSPAIQLHLVHQAPCNVPPYLSKNESNLGDL
LLGFLKYYATEFDWNSQMISVREAKAIPRPDGIEWRNKYICVEEPFDGTNTARAVHEKQKFDMIKDQFLKSWHRLKNKRDLNSILPVRAAVLKR
Isoform 2:
| Sequence length: | 480 aa |
| Molecular weight: | 55.502 kDa |
| Isoelectric point: | 9.72 |
1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130
MFPNSILGRPPFTPNHQQHNNFFTLSPTVYSHQQLIDAQFNFQNADLSRAVSLQQLTYGNVSPIQTSASPLFRGRKRLSDEKNLPLDGKRQRFHSPHQEPTVVNQIVPLSGERRYSMPPLFHTHYVPDIV
RCVPPFREIAFLEPREITLPEAKDKLSQQILELFETCQQQISDLKKKELCRTQLQREIQLLFPQSRLFLVGSSLNGFGTRSSDGDLCLVVKEEPVNQKTEARHILTLVHKHFCTRLSGYIERPQLIRAKV
PIVKFRDKVSCVEFDLNVNNIVGIRNTFLLRTYAYLENRVRPLVLVIKKWASHHQINDASRGTLSSYSLVLMVLHYLQTLPEPILPSLQKIYPESFSPAIQLHLVHQAPCNVPPYLSKNESNLGDLLLGF
LKYYATEFDWNSQMISVREAKAIPRPDGIEWRNKYICVEEPFDGTNTARAVHEKQKFDMIKDQFLKSWHRLKNKRDLNSILPVRAAVLKR
Enzyme
EC number: 2.7.7.19
Name: Polynucleotide adenylyltransferase
Reaction: ATP + RNA(n) <=> diphosphate + RNA(n+1)
Gene location: 5q14.1
Summary
Cytoplasmic poly(A) RNA polymerase that adds successive AMP monomers to the 3'-end of specific RNAs, forming a poly(A) tail. In contrast to the canonical nuclear poly(A) RNA polymerase, it only adds poly(A) to selected cytoplasmic mRNAs. Does not play a role in replication-dependent histone mRNA degradation.
Interacts with CPEB1, CPEB2, CPSF1 and PABPC1
Expressed in brain (cerebellum, hippocampus and medulla).
See this protein in other databases:
Literature:
- Kwak JE, Wang L, Ballantyne S et al. Mammalian GLD-2 homologs are poly(A) polymerases. Proc Natl Acad Sci U S A 2004 101(13):4407-12, doi: 10.1073/pnas.0400779101, PMID: 15070731.
- Rouhana L, Wang L, Buter N et al. Vertebrate GLD2 poly(A) polymerases in the germline and the brain. RNA 2005 11(7):1117-30, doi: 10.1261/rna.2630205, PMID: 15987818.
- Kwak JE, Drier E, Barbee SA et al. GLD2 poly(A) polymerase is required for long-term memory. Proc Natl Acad Sci U S A 2008 105(38):14644-9, doi: 10.1073/pnas.0803185105, PMID: 18780789.
- Sartain CV, Cui J, Meisel RP et al. The poly(A) polymerase GLD2 is required for spermatogenesis in Drosophila melanogaster. Development 2011 138(8):1619-29, doi: 10.1242/dev.059618, PMID: 21427144.
- Thuresson AC, Astrom J, Astrom A et al. Multiple forms of poly(A) polymerases in human cells. Proc Natl Acad Sci U S A 1994 91(3):979-83, doi: , PMID: 8302877.
| Previous Mitochondrial poly(A) RNA poly... |
Home | Next Speckle targeted PIP5K1A-regul... |
|
|
