 |
||||||||
|
||||||||
 |
||||||||
Speckle targeted PIP5K1A-regulated poly(A) polymerase
Known also as: RNA-binding motif protein 21, RNA-binding protein 21, U6 snRNA-specific terminal uridylyltransferase 1
Known abbreviations: TUT1, PAPD2, RBM21, Star-PAP, STARPAP, TUTase, U6-TUTase
Yeast homolog: not known
Protein
Structures Models Domains Secondary structure Disorder |
This protein is highly disordered (59 % of residues are predicted to be disordered)
Top 3 models:
 |  |  |
| Template: 2b4v, chain A Method: hhsearch Fragment: 132-641 | Template: 1cvj, chain A Method: sparks Fragment: 1-132 | Template: 3bub, chain A Method: compass Fragment: 571-798 |
| Sequence length: | 874 aa |
| Molecular weight: | 93.847 kDa |
| Isoelectric point: | 5.9 |
Sequence:
1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130
MAAVDSDVESLPRGGFRCCLCHVTTANRPSLDAHLGGRKHRHLVELRAARKAQGLRSVFVSGFPRDVDSAQLSEYFLAFGPVASVVMDKDKGVFAIVEMGDVGAREAVLSQSQHSLGGHRLRVRPREQKE
FQSPASKSPKGAAPDSHQLAKALAEAADVGAQMIKLVGLRELSEAERQLRSLVVALMQEVFTEFFPGCVVHPFGSSINSFDVHGCDLDLFLDLGDLEEPQPVPKAPESPSLDSALASPLDPQALACTPAS
PPDSQPPASPQDSEALDFETPSSSLAPQTPDSALASETLASPQSLPPASPLLEDREEGDLGKASELAETPKEEKAEGAAMLELVGSILRGCVPGVYRVQTVPSARRPVVKFCHRPSGLHGDVSLSNRLAL
HNSRFLSLCSELDGRVRPLVYTLRCWAQGRGLSGSGPLLSNYALTLLVIYFLQTRDPPVLPTVSQLTQKAGEGEQVEVDGWDCSFPRDASRLEPSINVEPLSSLLAQFFSCVSCWDLRGSLLSLREGQAL
PVAGGLPSNLWEGLRLGPLNLQDPFDLSHNVAANVTSRVAGRLQNCCRAAANYCRSLQYQRRSSRGRDWGLLPLLQPSSPSSLLSATPIPLPLAPFTQLTAALVQVFREALGCHIEQATKRTRSEGGGTG
ESSQGGTSKRLKVDGQKNCCEEGKEEQQGCAGDGGEDRVEEMVIEVGEMVQDWAMQSPGQPGDLPLTTGKHGAPGEEGQPSHAALAERGPKGHEAAQEWSQGEAGKGASLPSSASWRCALWHRVWQGRRR
ARRRLQQQTKEGAGGGAGTRAGWLATEAQVTQELKGLSGGEERPETEPLLSFVASVSPADRMLTVTPLQDPQGLFPDLHHFLQVFLPQAIRHLK
Enzyme
EC number: 2.7.7.19
Name: Polynucleotide adenylyltransferase
Reaction: ATP + RNA(n) <=> diphosphate + RNA(n+1)
EC number: 2.7.7.52
Name: RNA uridylyltransferase
Reaction: UTP + RNA(n) <=> diphosphate + RNA(n+1)
Gene location: 11q12.2
Summary
TUT1 is a nucleotidyl transferase that functions both as a terminal uridylyltransferase and as a nuclear poly(A) polymerase. The enzyme specifically adds and removes nucleotides from the 3' end of small nuclear RNAs and select mRNAs and may function in controlling gene expression and cell proliferation.
Localizes to nuclear speckles together with PIP5K1A and mediates polyadenylation of a select set of mRNAs, such as HMOX1. In addition to polyadenylation, it is also required for the 3'-end cleavage of pre-mRNAs: binds to the 3'UTR of targeted pre-mRNAs and promotes the recruitment and assembly of the CPSF complex on the 3'UTR of pre-mRNAs.
As the ATP ratio is higher than UTP in cells, suggesting that TUT1 functions primarily as a poly(A) polymerase. Acts as a specific terminal uridylyltransferase for U6 snRNA in vitro: responsible for a controlled elongation reaction that results in the restoration of the four 3'-terminal UMP-residues found in newly transcribed U6 snRNA. Not involved in replication-dependent histone mRNA degradation.
Associates with the cleavage and polyadenylation specificity factor (CPSF) complex. Interacts with CPSF1 and CPSF3; the interaction is direct. Interacts with PIP5K1A; interaction.
Phosphorylated by CK1 in the proline-rich (Pro-rich) region. Phosphorylated upon DNA damage, probably by ATM or ATR.
See this protein in other databases:
Literature:
- Trippe R, Guschina E, Hossbach M et al. Identification, cloning, and functional analysis of the human U6 snRNA-specific terminal uridylyl transferase. RNA 2006 12(8):1494-504, doi: 10.1261/rna.87706, PMID: 16790842.
- Mellman DL, Gonzales ML, Song C et al. A PtdIns4,5P2-regulated nuclear poly(A) polymerase controls expression of select mRNAs. Nature 2008 451(7181):1013-7, doi: 10.1038/nature06666, PMID: 18288197.
- Laishram RS, Anderson RA. The poly A polymerase Star-PAP controls 3"-end cleavage by promoting CPSF interaction and specificity toward the pre-mRNA. EMBO J 2010 29(24):4132-45, doi: 10.1038/emboj.2010.287, PMID: 21102410.
- Li W, Laishram RS, Ji Z et al. Star-PAP control of BIK expression and apoptosis is regulated by nuclear PIPKIalpha and PKCdelta signaling. Mol Cell 2012 45(1):25-37, doi: 10.1016/j.molcel.2011.11.017, PMID: 22244330.
- Li W, Laishram RS, Anderson RA et al. The novel poly(A) polymerase Star-PAP is a signal-regulated switch at the 3"-end of mRNAs. Adv Biol Regul 2012 00:, doi: 10.1016/j.jbior.2012.10.004, PMID: 23306079.
- Thuresson AC, Astrom J, Astrom A et al. Multiple forms of poly(A) polymerases in human cells. Proc Natl Acad Sci U S A 1994 91(3):979-83, doi: , PMID: 8302877.
| Previous Poly(A) RNA polymerase GLD2 |
Home | Next Cleavage and polyadenylation s... |
|
|
