 |
||||||||
|
||||||||
 |
||||||||
Cleavage and polyadenylation specificity factor subunit 1
Known also as: Cleavage and polyadenylation specificity factor 160
Known abbreviations: CPSF1, CPSF160, HSU37012, P/cl.18
Yeast homolog: CFT1
Protein
Domains Secondary structure NTD, CTD |
Top 3 models:
 |  |  |
| Template: 3ei3, chain A Method: hhsearch Fragment: 1-990 | Template: 3ei3, chain A Method: pdbblast Fragment: 2-629 | Template: 3e0c, chain A Method: compass Fragment: 5-979 |
| Sequence length: | 1443 aa |
| Molecular weight: | 160.884 kDa |
| Isoelectric point: | 6.14 |
Sequence:
1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130
MYAVYKQAHPPTGLEFSMYCNFFNNSERNLVVAGTSQLYVYRLNRDAEALTKNDRSTEGKAHREKLELAASFSFFGNVMSMASVQLAGAKRDALLLSFKDAKLSVVEYDPGTHDLKTLSLHYFEEPELRD
GFVQNVHTPRVRVDPDGRCAAMLVYGTRLVVLPFRRESLAEEHEGLVGEGQRSSFLPSYIIDVRALDEKLLNIIDLQFLHGYYEPTLLILFEPNQTWPGRVAVRQDTCSIVAISLNITQKVHPVIWSLTS
LPFDCTQALAVPKPIGGVVVFAVNSLLYLNQSVPPYGVALNSLTTGTTAFPLRTQEGVRITLDCAQATFISYDKMVISLKGGEIYVLTLITDGMRSVRAFHFDKAAASVLTTSMVTMEPGYLFLGSRLGN
SLLLKYTEKLQEPPASAVREAADKEEPPSKKKRVDATAGWSAAGKSVPQDEVDEIEVYGSEAQSGTQLATYSFEVCDSILNIGPCANAAVGEPAFLSEEFQNSPEPDLEIVVCSGHGKNGALSVLQKSIR
PQVVTTFELPGCYDMWTVIAPVRKEEEDNPKGEGTEQEPSTTPEADDDGRRHGFLILSREDSTMILQTGQEIMELDTSGFATQGPTVFAGNIGDNRYIVQVSPLGIRLLEGVNQLHFIPVDLGAPIVQCA
VADPYVVIMSAEGHVTMFLLKSDSYGGRHHRLALHKPPLHHQSKVITLCLYRDLSGMFTTESRLGGARDELGGRSGPEAEGLGSETSPTVDDEEEMLYGDSGSLFSPSKEEARRSSQPPADRDPAPFRAE
PTHWCLLVRENGTMEIYQLPDWRLVFLVKNFPVGQRVLVDSSFGQPTTQGEARREEATRQGELPLVKEVLLVALGSRQSRPYLLVHVDQELLIYEAFPHDSQLGQGNLKVRFKKVPHNINFREKKPKPSK
KKAEGGGAEEGAGARGRVARFRYFEDIYGYSGVFICGPSPHWLLVTGRGALRLHPMAIDGPVDSFAPFHNVNCPRGFLYFNRQGELRISVLPAYLSYDAPWPVRKIPLRCTAHYVAYHVESKVYAVATST
NTPCARIPRMTGEEKEFETIERDERYIHPQQEAFSIQLISPVSWEAIPNARIELQEWEHVTCMKTVSLRSEETVSGLKGYVAAGTCLMQGEEVTCRGRILIMDVIEVVPEPGQPLTKNKFKVLYEKEQKG
PVTALCHCNGHLVSAIGQKIFLWSLRASELTGMAFIDTQLYIHQMISVKNFILAADVMKSISLLRYQEESKTLSLVSRDAKPLEVYSVDFMVDNAQLGFLVSDRDRNLMVYMYLPEAKESFGGMRLLRRA
DFHVGAHVNTFWRTPCRGATEGLSKKSVVWENKHITWFATLDGGIGLLLPMQEKTYRRLLMLQNALTTMLPHHAGLNPRAFRMLHVDRRTLQNAVRNVLDGELLNRYLYLSTMERSELAKKIGTTPDIIL
DDLLETDRVTAHF
Gene location: 8q24.23
Summary
CPSF1 is the largest subunit of the cleavage and polyadenylation specificity factor (CPSF) complex. It plays a central role in 3-prime processing of pre-mRNAs. CPSF recognizes the AAUAAA signal (PAS sequence) in the pre-mRNA and interacts with other proteins to facilitate both RNA cleavage and poly(A) synthesis.
CPSF-160 is conserved throughout eukaryotes (24% identity and 51% similarity between CPSF-160 and Cft1p/Yhh1p)
Besides its role in 3?-end processing, it associates with factors involved in transcriptional initiation (TFIID) and elongation (PolII CTD), and plays a role in transcriptional termination.
Human CPSF-160 contains two RNP-type binding motifs near the N-terminus (RNP1, residues 379–386 and RNP2, residues 344–349), but it is not known whether these residues directly interact with RNA. A total of sixteen ?-propeller repeats were identified in human CPSF-160 based on sequence analysis.
Found in a complex with CPSF1, FIP1L1 and PAPOLA.
Interacts with FIP1L1, PAPD4/GLD2 and SRRM1.
Interacts with TUT1; the interaction is direct and mediates the recruitment of the CPSF complex on the 3'UTR of selected pre-mRNAs.
See this protein in other databases:
Literature:
- Samiotaki M, Balatsos NA, Courtis N et al. Assignment of the 160-kDa subunit of cleavage and polyadenylation specificity factor (CPSF1) to human chromosome 8q24.23 by radiation hybrid mapping. Cytogenet Cell Genet 2000 90(3-4):234-5, doi: 56776, PMID: 11124521.
- McCracken S, Lambermon M, Blencowe BJ et al. SRm160 splicing coactivator promotes transcript 3"-end cleavage. Mol Cell Biol 2002 22(1):148-60, doi: , PMID: 11739730.
- Murthy KG, Manley JL. Characterization of the multisubunit cleavage-polyadenylation specificity factor from calf thymus. J Biol Chem 1992 267(21):14804-11, doi: , PMID: 1634525.
- Murthy KG, Manley JL. The 160-kD subunit of human cleavage-polyadenylation specificity factor coordinates pre-mRNA 3"-end formation. Genes Dev 1995 9(21):2672-83, doi: , PMID: 7590244.
- Lutz CS, Murthy KG, Schek N et al. Interaction between the U1 snRNP-A protein and the 160-kD subunit of cleavage-polyadenylation specificity factor increases polyadenylation efficiency in vitro. Genes Dev 1996 10(3):325-37, doi: , PMID: 8595883.
| Previous Speckle targeted PIP5K1A-regul... |
Home | Next Cleavage and polyadenylation s... |
|
|
