|
Cleavage and polyadenylation specificity factor subunit 3Known also as: Cleavage and polyadenylation specificity factor 73 kDa subunit, mRNA 3'-end-processing endonuclease CPSF-73 Known abbreviations: CPSF3, CPSF-73, CPSF73 Yeast homolog: YSH1 Protein
Top 3 models:
Sequence: 1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130 MSAIPAEESDQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLISHFHLDHCGALPWFLQKTSFKGRTFMTHATKAIYRWLLSDYVKVSNISADDMLYTETDLEE SMDKIETINFHEVKEVAGIKFWCYHAGHVLGAAMFMIEIAGVKLLYTGDFSRQEDRHLMAAEIPNIKPDILIIESTYGTHIHEKREEREARFCNTVHDIVNRGGRGLIPVFALGRAQELLLILDEYWQNH PELHDIPIYYASSLAKKCMAVYQTYVNAMNDKIRKQININNPFVFKHISNLKSMDHFDDIGPSVVMASPGMMQSGLSRELFESWCTDKRNGVIIAGYCVEGTLAKHIMSEPEEITTMSGQKLPLKMSVDY ISFSAHTDYQQTSEFIRALKPPHVILVHGEQNEMARLKAALIREYEDNDEVHIEVHNPRNTEAVTLNFRGEKLAKVMGFLADKKPEQGQRVSGILVKRNFNYHILSPCDLSNYTDLAMSTVKQTQAIPYT GPFNLLCYQLQKLTGDVEELEIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDDSILSVTVDGKTANLNLET RTVECEEGSEDDESLREMVELAAQRLYEALTPVH Enzyme EC number: 3.1.27.- Name: Endoribonucleases producing other than 5'-phosphomonoesters Reaction: Gene location: 2p25.1 Summary CPSF3 is a 73kDa subunit of the cleavage and polyadenylation specificity factor and functions as an endonuclease that recognizes the pre-mRNA 3'-cleavage site AAUAAA prior to polyadenylation. It also cleaves after the pre-mRNA sequence ACCCA during histone 3'-end pre-mRNA processing. It is a member of the metallo-beta-lactamase family. Interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition.Also involved in the histone 3'-end pre-mRNA processing. U7 snRNP-dependent protein that induces both the 3'-endoribonucleolytic cleavage of histone pre-mRNAs and acts as a 5' to 3' exonuclease for degrading the subsequent downstream cleavage product (DCP) of mature histone mRNAs. Cleavage occurs after the 5'-ACCCA-3' sequence in the histone pre-mRNA leaving a 3'hydroxyl group on the upstream fragment containing the stem loop (SL) and 5' phosphate on the downstream cleavage product (DCP) starting with CU nucleotides. The U7-dependent 5' to 3' exonuclease activity is processive and degrades the DCP RNA substrate even after complete removal of the U7-binding site. Binds to the downstream cleavage product (DCP) of histone pre-mRNAs and the cleaved DCP RNA substrate in a U7 snRNP dependent manner. Interacts with CPSF2, CSTF2, WDR33 and SYMPK. Interacts with TUT1; the interaction is direct and mediates the recruitment of the CPSF complex on the 3'UTR of pre-mRNAs. While the N-terminal region active and highly conserved metallo-beta-lactamase domain, the C-terminal region of CPSF-73 is not as conserved, but removal of the C-terminus of Brr5p/Ysh1p (yeast homolog), by as little as the last 30 residues, results in cell death. Sequence analysis suggests that a leucine zipper, which is usually involved in protein-protein interactions, may be present in the final 30 residues of Brr5p/Ysh1p. The C-terminus of CPSF-73 does interact with other proteins in the 3?-end processing complex, including CPSF-100 and Pta1p. This association may bridge CPSF with CF IIm in mammals . CPSF-73 has a second isoform in humans, known as RC-68 or Int9. It may be involved in 3?-end processing of small nuclear RNAs and it interacts with the second isoform of CPSF-100, RC-74 or Int11. See this protein in other databases: Literature:
|
||||||||||||||||||||||||||||||
|