 |
||||||||
|
||||||||
 |
||||||||
Poly(A) polymerase beta
Known also as: Polynucleotide adenylyltransferase beta, Testis-specific poly(A) polymerase
Known abbreviations: PAPOLB, PAPT, TPAP
Yeast homolog: not known
Protein
Models Domains Secondary structure Disorder |
Top 3 models:
 |  |  |
| Template: 3c66, chain A Method: compass Fragment: 1-497 | Template: 2q66, chain A Method: csblast Fragment: 17-436 | Template: 3dxj, chain N Method: compass Fragment: 371-630 |
| Sequence length: | 636 aa |
| Molecular weight: | 71.681 kDa |
| Isoelectric point: | 6.18 |
Sequence:
1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130
MPFPVTTQGPPQPAPPPNRYGVSSPISLAVPKETDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESKSLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPSHVDRSDFF
TSFYAKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPNIDNFRLTLRAIKLWAKCHNIYSNILGFLGGVSWAMLVARTCQLY
PNAVASTLVRKFFLVFSEWEWPNPVLLKEPEERNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSISTRMVMIEEFKQGLAITHEILLSKAEWSKLFEAPSFFQKYKHYIVLLASASTEKQHLEW
VGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPKENPDMEEFRTMWVIGLGLKKPDNSEILSIDLTYDIQSFTDTVYRQAVNSKMFEMGMKITAMHLRRKELHQLLPHHVLQDKKAHSTEGRRLTDLND
SSFDLSAGCENSMSVPSSTSTMKTGPLISSSQGRNSPALAVMTASVANIQATEFSLQQVNTNESSGVALNESIPHAVSQPAISPSPKAMVARVVSSTCLISHPDLQETQQQTYLIL
Enzyme
EC number: 2.7.7.19
Name: Polynucleotide adenylyltransferase
Reaction: ATP + RNA(n) <=> diphosphate + RNA(n+1)
Gene location: 7p22.1
Summary
The protein belongs to the poly(A) polymerase family. It is required for the addition of adenosine residues for the creation of the 3'-poly(A) tail of mRNAs. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Interacts with GSG1
Testis specific.
See this protein in other databases:
Literature:
- Kashiwabara S, Zhuang T, Yamagata K et al. Identification of a novel isoform of poly(A) polymerase, TPAP, specifically present in the cytoplasm of spermatogenic cells. Dev Biol 2000 228(1):106-15, doi: 10.1006/dbio.2000.9894, PMID: 11087630.
- Le YJ, Kim H, Chung JH et al. Testis-specific expression of an intronless gene encoding a human poly(A) polymerase. Mol Cells 2001 11(3):379-85, doi: , PMID: 11459229.
- Kashiwabara S, Noguchi J, Zhuang T et al. Regulation of spermatogenesis by testis-specific, cytoplasmic poly(A) polymerase TPAP. Science 2002 298(5600):1999-2002, doi: 10.1126/science.1074632, PMID: 12471261.
- Zhuang T, Kashiwabara S, Noguchi J et al. Transgenic expression of testis-specific poly(A) polymerase TPAP in wild-type and TPAP-deficient mice. J Reprod Dev 2004 50(2):207-13, doi: , PMID: 15118248.
- Thuresson AC, Astrom J, Astrom A et al. Multiple forms of poly(A) polymerases in human cells. Proc Natl Acad Sci U S A 1994 91(3):979-83, doi: , PMID: 8302877.
| Previous Poly(A) polymerase alpha |
Home | Next Poly(A) polymerase gamma |
|
|
