Poly(A) polymerase gamma

Known also as: Neo-poly(A) polymerase, Polynucleotide adenylyltransferase gamma, SRP RNA 3'-adenylating enzyme
Known abbreviations: PAPOLG, Neo-PAP, PAP-gamma, PAP2, PAPG

Yeast homolog: PAP

Protein

1 736 PAP_central PAP_RNA-bind

Models Domains Secondary structure Disorder

Top 3 models:

Template: 1q79, chain A Method: hhsearch Fragment: 1-513	Template: 2hhp, chain A Method: hhsearch Fragment: 13-504	Template: 1twg, chain A Method: phyre Fragment: 424-732

Sequence length:	736 aa
Molecular weight:	82.803 kDa
Isoelectric point:	9.47

Sequence:
1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130
MKEMSANTVLDSQRQQKHYGITSPISLASPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEWISDVSESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFQ
SFFEKLKHQDGIRNLRAVEDAFVPVIKFEFDGIEIDLVFARLAIQTISDNLDLRDDSRLRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLTLRAVKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYP
NAAASTLVHKFFLVFSKWEWPNPVLLKQPEESNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSTSTRTVMVEEFKQGLAVTDEILQGKSDWSKLLEPPNFFQKYRHYIVLTASASTEENHLEWV
GLVESKIRVLVGNLERNEFITLAHVNPQSFPGNKEHHKDNNYVSMWFLGIIFRRVENAESVNIDLTYDIQSFTDTVYRQANNINMLKEGMKIEATHVKKKQLHHYLPAEILQKKKKQSLSDVNRSSGGLQ
SKRLSLDSSCLDSSRDTDNGTPFNSPASKSDSPSVGETERNSAEPAAVIVEKPLSVPPAQGLSIPVIGAKVDSTVKTVSPPTVCTIPTVVGRNVIPRITTPHNPAQGQPHLNGMSNITKTVTPKRSHSPS
IDGTPKRLKDVEKFIRLESTFKDPRTAEERKRKSVDAIGGESMPIPTIDTSRKKRLPSKELPDSSSPVPANNIRVIKNSIRLTLNR

Enzyme
EC number: 2.7.7.19
Name: Polynucleotide adenylyltransferase
Reaction: ATP + RNA(n) <=> diphosphate + RNA(n+1)

Gene location: 2p16.1


Summary
PAPOLG is a member of the poly(A) polymerase family which catalyzes template-independent extension of the 3' end of a DNA/RNA strand. This enzyme shares 60% identity to the well characterized poly(A) polymerase II (PAPII) at the amino acid level. These two enzymes have similar organization of structural and functional domains. This enzyme is exclusively localized in the nucleus and exhibits both nonspecific and CPSF (cleavage and polyadenylation specificity factor)/AAUAAA-dependent polyadenylation activity. The gene is located on chromosome 2 in contrast to the PAPII gene, which is located on chromosome 14.

Responsible for the post-transcriptional adenylation of the 3'-terminal of mRNA precursors and several small RNAs including signal recognition particle (SRP) RNA, nuclear 7SK RNA, U2 small nuclear RNA, and ribosomal 5S RNA.

Expressed predominantly in testis, and weakly in other tissues. Overexpressed in several tumors.

See this protein in other databases:
       

Literature:

• Kyriakopoulou CB, Nordvarg H, Virtanen A et al. A novel nuclear human poly(A) polymerase (PAP), PAP gamma. J Biol Chem 2001 276(36):33504-11, doi: 10.1074/jbc.M104599200, PMID: 11431479.
• Topalian SL, Kaneko S, Gonzales MI et al. Identification and functional characterization of neo-poly(A) polymerase, an RNA processing enzyme overexpressed in human tumors. Mol Cell Biol 2001 21(16):5614-23, doi: 10. 1128/MCB.21.16.5614-5623.2001, PMID: 11463842.
• Thuresson AC, Astrom J, Astrom A et al. Multiple forms of poly(A) polymerases in human cells. Proc Natl Acad Sci U S A 1994 91(3):979-83, doi: , PMID: 8302877.

Additional computationally mapped references ...

Previous Poly(A) polymerase beta

Home

Next Mitochondrial poly(A) RNA poly...