![]() |
![]() |
||||||||||||||||||||||||||||||
|
Poly(A) polymerase gammaKnown also as: Neo-poly(A) polymerase, Polynucleotide adenylyltransferase gamma, SRP RNA 3'-adenylating enzyme Known abbreviations: PAPOLG, Neo-PAP, PAP-gamma, PAP2, PAPG Yeast homolog: PAP Protein
This protein is highly disordered (37 % of residues are predicted to be disordered)
Top 3 models:
Sequence: 1........10........20........30........40........50........60........70........80........90........100.......110.......120.......130 MKEMSANTVLDSQRQQKHYGITSPISLASPKEIDHIYTQKLIDAMKPFGVFEDEEELNHRLVVLGKLNNLVKEWISDVSESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVERSDFFQ SFFEKLKHQDGIRNLRAVEDAFVPVIKFEFDGIEIDLVFARLAIQTISDNLDLRDDSRLRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLTLRAVKLWAKRRGIYSNMLGFLGGVSWAMLVARTCQLYP NAAASTLVHKFFLVFSKWEWPNPVLLKQPEESNLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNVSTSTRTVMVEEFKQGLAVTDEILQGKSDWSKLLEPPNFFQKYRHYIVLTASASTEENHLEWV GLVESKIRVLVGNLERNEFITLAHVNPQSFPGNKEHHKDNNYVSMWFLGIIFRRVENAESVNIDLTYDIQSFTDTVYRQANNINMLKEGMKIEATHVKKKQLHHYLPAEILQKKKKQSLSDVNRSSGGLQ SKRLSLDSSCLDSSRDTDNGTPFNSPASKSDSPSVGETERNSAEPAAVIVEKPLSVPPAQGLSIPVIGAKVDSTVKTVSPPTVCTIPTVVGRNVIPRITTPHNPAQGQPHLNGMSNITKTVTPKRSHSPS IDGTPKRLKDVEKFIRLESTFKDPRTAEERKRKSVDAIGGESMPIPTIDTSRKKRLPSKELPDSSSPVPANNIRVIKNSIRLTLNR Enzyme EC number: 2.7.7.19 Name: Polynucleotide adenylyltransferase Reaction: ATP + RNA(n) <=> diphosphate + RNA(n+1) Gene location: 2p16.1 ![]() Summary PAPOLG is a member of the poly(A) polymerase family which catalyzes template-independent extension of the 3' end of a DNA/RNA strand. This enzyme shares 60% identity to the well characterized poly(A) polymerase II (PAPII) at the amino acid level. These two enzymes have similar organization of structural and functional domains. This enzyme is exclusively localized in the nucleus and exhibits both nonspecific and CPSF (cleavage and polyadenylation specificity factor)/AAUAAA-dependent polyadenylation activity. The gene is located on chromosome 2 in contrast to the PAPII gene, which is located on chromosome 14. Responsible for the post-transcriptional adenylation of the 3'-terminal of mRNA precursors and several small RNAs including signal recognition particle (SRP) RNA, nuclear 7SK RNA, U2 small nuclear RNA, and ribosomal 5S RNA. Expressed predominantly in testis, and weakly in other tissues. Overexpressed in several tumors. See this protein in other databases: ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() Literature:
|
||||||||||||||||||||||||||||||
|